Scribd Logo
Upload

Welcome to Scribd!

  • 8 views

    GPT (Mouse) Recombinant Protein: Applications

    Uploaded by

    hui luo
    This document provides information about a recombinant mouse Gpt protein product. It includes the catalog number, size, sequence, theoretical molecular weight, purity, activity, storage buffer, and applications. The protein is expressed in E. coli as a full-length protein with a His tag. It has a purity greater than 90% and a specific activity of more than 40 units/mg. The protein is supplied in a phosphate-buffered saline storage buffer and is recommended to be stored at -20°C to -80°C for long term storage.

    Copyright:

    © All Rights Reserved
    Download as PDF, TXT or read online from Scribd

    GPT (Mouse) Recombinant Protein: Applications

    Uploaded by

    hui luo
    8 views2 pages
    This document provides information about a recombinant mouse Gpt protein product. It includes the catalog number, size, sequence, theoretical molecular weight, purity, activity, storage buffer, and applications. The protein is expressed in E. coli as a full-length protein with a His tag. It has a purity greater than 90% and a specific activity of more than 40 units/mg. The protein is supplied in a phosphate-buffered saline storage buffer and is recommended to be stored at -20°C to -80°C for long term storage.

    Original Description:

    Original Title

    P8007

    Copyright

    © © All Rights Reserved

    Available Formats

    PDF, TXT or read online from Scribd

    Did you find this document useful?

    Is this content inappropriate?

    This document provides information about a recombinant mouse Gpt protein product. It includes the catalog number, size, sequence, theoretical molecular weight, purity, activity, storage buffer, and applications. The protein is expressed in E. coli as a full-length protein with a His tag. It has a purity greater than 90% and a specific activity of more than 40 units/mg. The protein is supplied in a phosphate-buffered saline storage buffer and is recommended to be stored at -20°C to -80°C for long term storage.

    Copyright:

    © All Rights Reserved
    Download as PDF, TXT or read online from Scribd
    Download as pdf or txt
    8 views2 pages

    GPT (Mouse) Recombinant Protein: Applications

    Uploaded by

    hui luo
    This document provides information about a recombinant mouse Gpt protein product. It includes the catalog number, size, sequence, theoretical molecular weight, purity, activity, storage buffer, and applications. The protein is expressed in E. coli as a full-length protein with a His tag. It has a purity greater than 90% and a specific activity of more than 40 units/mg. The protein is supplied in a phosphate-buffered saline storage buffer and is recommended to be stored at -20°C to -80°C for long term storage.

    Copyright:

    © All Rights Reserved
    Download as PDF, TXT or read online from Scribd
    Download as pdf or txt
    of 2

    Gpt (Mouse) Recombinant Protein

    Catalog # P8007 Size 100 ug

    Applications

    Specification
    Product Description Mouse Gpt (Q8QZR5, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in Esc
    herichia coli.

    Sequence MASQRNDRIQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIR
    ANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPI
    REDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVAGEGRARTGVLIPIPQYPLYSAALAELD
    AVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECIEAVIRFAFEE
    GLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVE
    VVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKA
    KLTEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGS
    GFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEYS

    Host Escherichia coli

    Theoretical MW (kDa) 57.5

    Form Liquid

    Preparation Method Escherichia coli expression system

    Purity > 90% by SDS-PAGE

    Endotoxin Level < 1 EU per 1 ug of protein (determined by LAL method)

    Copyright © 2023 Abnova Corporation. All Rights Reserved.


    Activity Specific activity is > 40 unit/mg, and is defined as the amount of enzyme that convert 1 umole of L-Al
    anine to L-Glutamate per minute at pH 7.5 at 37°C.

    Quality Control Testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT)

    Storage Instruction Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.

    Applications

    Functional Study

    SDS-PAGE

    Gene Info — Gpt


    Entrez GeneID 76282

    Protein Accession# Q8QZR5

    Gene Name Gpt

    Gene Alias 1300007J06Rik, 2310022B03Rik, ALT, Gpt-1, Gpt1

    Gene Description glutamic pyruvic transaminase, soluble

    Gene Ontology Hyperlink

    Gene Summary O

    Other Designations glutamic pyruvic transaminase 1, soluble

    Copyright © 2023 Abnova Corporation. All Rights Reserved.

    You might also like