SBP 태그
SBP-tag이 문서에서는 혼란스럽거나 애매할 수 있는 약어를 사용하고 있습니다.(2012년 1월 (이 의 방법과 을 확인합니다) |
Streptavidin-Binding 펩타이드(SBP)-Tag는 38-아미노산 배열로, 재조합 단백질로 제작될 수 있다.SBP-Tag를 포함한 재조합 단백질은 스트렙타비딘에 결합하며, 이 성질은 특정 정제, 검출 또는 고정화 전략에 [citation needed]이용될 수 있다.
SBP 태그의 시퀀스는 MDEKTTGWRGHVVEGLAGLELEQLARHHPQREP입니다.[1]
검출
스트렙타비딘 결합 펩타이드는 mRNA Display의 시험관내 선택 기법을 사용하여 7조 개의 확률적으로 생성된 펩타이드의 라이브러리 내에서 발견되었다.선택은 스트렙타비딘-아가로스로 배양한 후 비오틴으로 [2]용출하여 수행되었다.SBP-Tag는 2.5nM의[1][2] 평형 해리 상수로 스트렙타비딘과 결합하는 것으로 나타났으며, 자연 [1][2]조건 하에서 비오틴과 쉽게 용출된다.
적용들
단백질 정제
경도의 용출 조건(비오틴+워시 버퍼)에 의해 SBP-태그 부착 단백질은 단일 정제 [1][3][4]공정으로 비교적 순수한 상태로 생성될 수 있다.보다 일반적으로 사용되는 폴리히스티딘 태그(His-tag)와 결합하는 IMAC 매트릭스와 본질적으로 연관된 몇 가지 비교적 풍부한 포유동물 단백질이 있습니다.이러한 이유로 포유동물 [citation needed]세포에서 발현되는 단백질에는 SBP-Tag를 포함한 비 IMAC 정제 프로토콜이 선호된다.
단백질 복합 정제
비오틴과의 용출은 원하는 복합체가 연관된 상태로 있는 조건에서 회복을 허용하기 때문에 상호작용하는 단백질의 복합체는 SBP-Tag를 사용하여 정제될 수도 있다.예를 들어, 응축 복합체는 Kim 등에 의해 정제되었다.[2010] 및 TAZ 전사활성제와의 복합체는 장 외 연구진에 의해 정제되었다.[2009].그 SBP-Tag 또한 연속적인 정화 단계를 여러 태그로, 예 GFP를 융합 단백질과 BTK-protein 단지의 SBP-Tag고 His-Tag,[5][6]HDGF-protein 단지와 TAP프로토콜을 사용하고 정화됬다 활용되고 있는 여러 탠덤 어피니티 정화(TAP)시스템에 포함되고 있는 TAPp.을 사용하여 정화되었다rotocol SBP-Tag 및 FLAG-Tag[7] 및 Wnt 복합체와 함께 SBP-Tag 및 [Calmodulin-Tag][8]를 사용하여 정제되었다.TAP은 일반적으로 단백질 복합체와 함께 사용되며, SBP-Tag TAP 시스템을 비 SBP-Tag 시스템과 비교할 [9][10][11]때 순도 및 수율이 크게 향상된 것으로 여러 연구에서 보고되었습니다.SBP-Tag를 사용하는 상용 TAP 시스템에는 Agilent Technologies에서 판매하는 Interplay® Adenoviral 및 Pamortian TAP 시스템이 있으며, Sigma-Aldrich에서도 [12]유사한 제품을 판매하고 있습니다.
프로테오믹스
생물학적으로 관련 단백질-단백질 상호 교류를 위해 화면에는 그 SBP-Tag과 단백질 A,[10]과 SBP-Tag과 단백질 G,[10][13]로 하여금 SBP-Tag을 그 Dengue 바이러스 단백질 DENV-2 NS4A과 상호 작용하는 단백질을 위한 상호 작용 단백질 체학, 전사 인자에 대한 탠덤 어피니티 정화(TAP)를 사용하여 공연되었다.d는 CalmodSBP-Tag 및 헤마글루티닌(HA)-[11]태그와 함께 단백질 포스파타아제 2A(PP2A)와 상호작용하는 단백질의 경우 ulin [14]Tag.
이미징
SBP-Tag는 또한 용액에 있는 스트렙타비딘 또는 스트렙타비딘 시약과도 결합합니다.이러한 인공 협회의 응용에 시험관 안 번역에서 개인적인 단백질의 변형의 동역학의 cells,[15]감시 생활 내의 특정 단백질의 시각화를 포함하 system,[16]multi-spanning 막 단백질의 소포체에에 대한 SBP-Tag를 융합시켜 통합 제어입니다. N-terminal translocation sequence, streptavidin과의 통합을 중지하고 [17][18]biotin과의 통합을 다시 시작합니다.형광 스트렙타비딘 시약(예를 들어 스트렙타비딘-HRP)을 사용하여 SDS-PAGE의 [1][19][20]면역블로팅을 통해 SBP 태그를 시각화할 수 있습니다.또한 SBP 태그에 대한 항체가 시판되고 [citation needed]있다.
표면 플라즈몬 공명
SBP-Tag는 변형단백질을 스트렙타비딘 기능화 표면에 가역적으로 고정시키기 위해 사용되어 기능화 [21]표면의 재사용과 표면 플라즈몬 공명(SPR) 기술에 의한 상호작용 평가를 가능하게 했다.SPR은 또한 SBP-Tag를 Strep-tag와 [22]같은 다른 스트렙타비딘 결합 펩타이드와 비교하는 데 사용되었다.
「 」를 참조해 주세요.
레퍼런스
- ^ a b c d e Keefe, Anthony D.; Wilson, David S.; Seelig, Burckhard; Szostak, Jack W. (2001). "One-Step Purification of Recombinant Proteins Using a Nanomolar-Affinity Streptavidin-Binding Peptide, the SBP-Tag". Protein Expression and Purification. 23 (3): 440–6. doi:10.1006/prep.2001.1515. PMID 11722181.
- ^ a b c Wilson, David S.; Keefe, Anthony D.; Szostak, Jack W. (2001). "The use of mRNA display to select high-affinity protein-binding peptides". Proceedings of the National Academy of Sciences. 98 (7): 3750–5. Bibcode:2001PNAS...98.3750W. doi:10.1073/pnas.061028198. PMC 31124. PMID 11274392.
- ^ Ichikawa, Muneyoshi; Watanabe, Yuta; Murayama, Takashi; Toyoshima, Yoko Yano (2011). "Recombinant human cytoplasmic dynein heavy chain 1 and 2: Observation of dynein-2 motor activity in vitro". FEBS Letters. 585 (15): 2419–23. doi:10.1016/j.febslet.2011.06.026. PMID 21723285. S2CID 27909093.
- ^ Li, Feng; Herrera, Jeremy; Zhou, Sharleen; Maslov, Dmitri A.; Simpson, Larry (2011). "Trypanosome REH1 is an RNA helicase involved with the 3'-5' polarity of multiple gRNA-guided uridine insertion/deletion RNA editing". Proceedings of the National Academy of Sciences. 108 (9): 3542–7. Bibcode:2011PNAS..108.3542L. doi:10.1073/pnas.1014152108. PMC 3048136. PMID 21321231.
- ^ Li, Yifeng; Franklin, Sarah; Zhang, Michael J.; Vondriska, Thomas M. (2011). "Highly efficient purification of protein complexes from mammalian cells using a novel streptavidin-binding peptide and hexahistidine tandem tag system: Application to Bruton's tyrosine kinase". Protein Science. 20 (1): 140–9. doi:10.1002/pro.546. PMC 3047070. PMID 21080425.
- ^ Kobayashi, Takuya; Morone, Nobuhiro; Kashiyama, Taku; Oyamada, Hideto; Kurebayashi, Nagomi; Murayama, Takashi (2008). Imhof, Axel (ed.). "Engineering a Novel Multifunctional Green Fluorescent Protein Tag for a Wide Variety of Protein Research". PLOS ONE. 3 (12): e3822. Bibcode:2008PLoSO...3.3822K. doi:10.1371/journal.pone.0003822. PMC 2585475. PMID 19048102.
- ^ Zhao, Jian; Yu, Hongxiu; Lin, Ling; Tu, Jun; Cai, Lili; Chen, Yanmei; Zhong, Fan; Lin, Chengzhao; et al. (2011). "Interactome study suggests multiple cellular functions of hepatoma-derived growth factor (HDGF)". Journal of Proteomics. 75 (2): 588–602. doi:10.1016/j.jprot.2011.08.021. PMID 21907836.
- ^ Ahlstrom, Robert; Yu, Alan S. L. (2009). "Characterization of the kinase activity of a WNK4 protein complex". AJP: Renal Physiology. 297 (3): F685–92. doi:10.1152/ajprenal.00358.2009. PMC 2739714. PMID 19587141.
- ^ Kyriakakis, Phillip P.; Tipping, Marla; Abed, Louka; Veraksa, Alexey (2008). "Tandem affinity purification in Drosophila: The advantages of the GS-TAP system". Fly. 2 (4): 229–35. doi:10.4161/fly.6669. PMID 18719405.
- ^ a b c Bürckstümmer, Tilmann; Bennett, Keiryn L; Preradovic, Adrijana; Schütze, Gregor; Hantschel, Oliver; Superti-Furga, Giulio; Bauch, Angela (2006). "An efficient tandem affinity purification procedure for interaction proteomics in mammalian cells". Nature Methods. 3 (12): 1013–9. doi:10.1038/nmeth968. PMID 17060908. S2CID 7069058.
- ^ a b Glatter, Timo; Wepf, Alexander; Aebersold, Ruedi; Gstaiger, Matthias (2009). "An integrated workflow for charting the human interaction proteome: Insights into the PP2A system". Molecular Systems Biology. 5 (1): 237. doi:10.1038/msb.2008.75. PMC 2644174. PMID 19156129.
- ^ Li, Yifeng (2011). "The tandem affinity purification technology: An overview". Biotechnology Letters. 33 (8): 1487–99. doi:10.1007/s10529-011-0592-x. PMID 21424840. S2CID 157683.
- ^ Van Leene, Jelle; Eeckhout, Dominique; Persiau, Geert; Van De Slijke, Eveline; Geerinck, Jan; Van Isterdael, Gert; Witters, Erwin; De Jaeger, Geert (2011). "Isolation of Transcription Factor Complexes from Arabidopsis Cell Suspension Cultures by Tandem Affinity Purification". In Yuan, Ling; Perry, Sharyn E (eds.). Plant Transcription Factors. Methods in Molecular Biology. Vol. 754. pp. 195–218. doi:10.1007/978-1-61779-154-3_11. ISBN 978-1-61779-153-6. PMID 21720954.
- ^ Anwar, Azlinda; Leong, K. M.; Ng, Mary L.; Chu, Justin J. H.; Garcia-Blanco, Mariano A. (2009). "The Polypyrimidine Tract-binding Protein Is Required for Efficient Dengue Virus Propagation and Associates with the Viral Replication Machinery". Journal of Biological Chemistry. 284 (25): 17021–9. doi:10.1074/jbc.M109.006239. PMC 2719340. PMID 19380576.
- ^ McCann, Corey M.; Bareyre, Florence M.; Lichtman, Jeff W.; Sanes, Joshua R. (2005). "Peptide tags for labeling membrane proteins in live cells with multiple fluorophores". BioTechniques. 38 (6): 945–52. doi:10.2144/05386IT02. PMID 16018556.
- ^ Takahashi, Shuntaro; Iida, Masaaki; Furusawa, Hiroyuki; Shimizu, Yoshihiro; Ueda, Takuya; Okahata, Yoshio (2009). "Real-Time Monitoring of Cell-Free Translation on a Quartz-Crystal Microbalance". Journal of the American Chemical Society. 131 (26): 9326–32. doi:10.1021/ja9019947. PMID 19518055.
- ^ Kida, Yuichiro; Morimoto, Fumiko; Sakaguchi, Masao (2007). "Two translocating hydrophilic segments of a nascent chain span the ER membrane during multispanning protein topogenesis". The Journal of Cell Biology. 179 (7): 1441–52. doi:10.1083/jcb.200707050. PMC 2373506. PMID 18166653.
- ^ Kida, Y.; Morimoto, F.; Sakaguchi, M. (2008). "Signal Anchor Sequence Provides Motive Force for Polypeptide Chain Translocation through the Endoplasmic Reticulum Membrane". Journal of Biological Chemistry. 284 (5): 2861–6. doi:10.1074/jbc.M808020200. PMID 19010775.
- ^ Edelmann, Mariola J.; Iphöfer, Alexander; Akutsu, Masato; Altun, Mikael; Di Gleria, Katalin; Kramer, Holger B.; Fiebiger, Edda; Dhe-Paganon, Sirano; Kessler, Benedikt M. (2009). "Structural basis and specificity of human otubain 1-mediated deubiquitination". Biochemical Journal. 418 (2): 379–90. doi:10.1042/BJ20081318. PMID 18954305.
- ^ Hoer, Simon; Smith, Lorraine; Lehner, Paul J. (2007). "MARCH-IX mediates ubiquitination and downregulation of ICAM-1". FEBS Letters. 581 (1): 45–51. doi:10.1016/j.febslet.2006.11.075. PMID 17174307. S2CID 22461058.
- ^ Li, Yong-Jin; Bi, Li-Jun; Zhang, Xian-En; Zhou, Ya-Feng; Zhang, Ji-Bin; Chen, Yuan-Yuan; Li, Wei; Zhang, Zhi-Ping (2006). "Reversible immobilization of proteins with streptavidin affinity tags on a surface plasmon resonance biosensor chip". Analytical and Bioanalytical Chemistry. 386 (5): 1321–6. doi:10.1007/s00216-006-0794-6. PMID 17006676. S2CID 6074268.
- ^ Huang, Xu; Zhang, Xian-En; Zhou, Ya-Feng; Zhang, Zhi-Ping; Cass, Anthony E. G. (2007). "Construction of a high sensitive Escherichia coli alkaline phosphatase reporter system for screening affinity peptides". Journal of Biochemical and Biophysical Methods. 70 (3): 435–9. doi:10.1016/j.jbbm.2006.10.006. PMID 17156847.
추가 정보
- Kim, Ji Hun; Chang, Tsz M; Graham, Alison N; Choo, K HA; Kalitsis, Paul; Hudson, Damien F (2010). "Streptavidin-Binding Peptide (SBP)-tagged SMC2 allows single-step affinity fluorescence, blotting or purification of the condensin complex". BMC Biochemistry. 11: 50. doi:10.1186/1471-2091-11-50. PMC 3022668. PMID 21194474.
- Zhang, Heng; Liu, Chen-Ying; Zha, Zheng-Yu; Zhao, Bin; Yao, Jun; Zhao, Shimin; Xiong, Yue; Lei, Qun-Ying; Guan, Kun-Liang (2009). "TEAD Transcription Factors Mediate the Function of TAZ in Cell Growth and Epithelial-Mesenchymal Transition". Journal of Biological Chemistry. 284 (20): 13355–62. doi:10.1074/jbc.M900843200. PMC 2679435. PMID 19324877.